PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21737
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 88aa    MW: 10001.6 Da    PI: 9.8833
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21737genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
         EMT21737 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPVSTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129422.681965IPR017930Myb domain
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
SuperFamilySSF466891.73E-211588IPR009057Homeodomain-like
CDDcd001676.89E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-56588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRPPCCDKL GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PVSTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF TTHEEGIIVH LQSLLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-13128825100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3560901e-116AK356090.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1029P14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616542.15e-61PREDICTED: myb-related protein 306
SwissprotP813925e-58MYB06_ANTMA; Myb-related protein 306
TrEMBLW5ERP62e-61W5ERP6_WHEAT; Uncharacterized protein
STRINGLOC_Os11g03440.12e-60(Oryza sativa Japonica Group)
STRINGBGIOSGA034582-PA2e-60(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.19e-59myb domain protein 60